PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05911A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 445aa    MW: 47347.1 Da    PI: 6.2452
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05911AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.17e-391142141101
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                aCaaCk++rrkC++dC lapyfpae+++ f n+h+lFG++n++k+l+++++e  ++am++l+y++eara dPvyG+vg+i++l+
  Oropetium_20150105_05911A 114 ACAACKYQRRKCNPDCSLAPYFPAENQRLFLNAHRLFGVRNIQKTLQRISPEYGPEAMRALIYQSEARAADPVYGCVGIIKNLE 197
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkeel 101
                                ++++  +ael++l++++
  Oropetium_20150105_05911A 198 HKIHLYNAELEALHQQI 214
                                *************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.188113214IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-36114211IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MEDRSSERRK GKGREARSLF DSHPPSYRPS YPYDDADAEA EAPDLAGSRA RASRVTMSSS  60
SSFSSKPPPH LLHVDTTATT NGSAASPGSA SSSQSSRSSP RPSPAAGGSG QNQACAACKY  120
QRRKCNPDCS LAPYFPAENQ RLFLNAHRLF GVRNIQKTLQ RISPEYGPEA MRALIYQSEA  180
RAADPVYGCV GIIKNLEHKI HLYNAELEAL HQQIAIYRQA ATAVGGGGHP LAAGPPMLAA  240
APGQNNLAMT MHALYGGGGV HLQEPVHQAG AAGFAVVADQ QAGYNALNHV NVDDHGQDQH  300
QQQPHPLYDY FCYDGTPAEE ATSHDATMRH EFCYSDASAT QTGSSSGGMT TLREQLENHC  360
QIQAAPFVDA FDDVKPHGLP VMTEHHSQAH GGGGGIIEQP EQKVLPATAV VKYDDADQNM  420
ADDEPAAPAA GQCHLELGSS SFLN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0053884e-40AP005388.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0086F04.
GenBankAP0149644e-40AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126164e-40CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-37LOB domain-containing protein 22